PHF11 Antibody

Images

 
Western Blot: PHF11 Antibody [NBP1-80332] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF11 Antibody Summary

Immunogen
Synthetic peptide directed towards the n terminal of human PHF11. Peptide sequence MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFICCHC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against PHF11 and was validated on Western blot.
Control
PHF11 Knockout A549 Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PHF11 Antibody

  • APY
  • BCAPIGHER
  • BRCA1 C-terminus-associated protein
  • IgE responsiveness (atopic)
  • IGEL
  • IGER
  • NY-REN-34 antigen
  • NYREN34
  • NY-REN-34
  • PHD finger protein 11
  • Renal carcinoma antigen NY-REN-34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01249
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB5565
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
NBP1-44315
Species: Hu, Mu, Rt, Ha, Pm
Applications: IHC, IHC-P
NBP2-03109
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-24677
Species: Hu, Ca, Eq, Pm
Applications: WB, ICC/IF, IHC, IHC-P
M1300CB
Species: Mu
NB7343
Species: Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1137
Species: Hu
Applications: WB, ICC/IF, IP, PEP-ELISA, ChIP
NBP2-31807
Species: Hu
Applications: IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NBP1-80332
Species: Hu
Applications: WB

Publications for PHF11 Antibody (NBP1-80332) (0)

There are no publications for PHF11 Antibody (NBP1-80332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF11 Antibody (NBP1-80332) (0)

There are no reviews for PHF11 Antibody (NBP1-80332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF11 Antibody (NBP1-80332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PHF11 Products

Bioinformatics Tool for PHF11 Antibody (NBP1-80332)

Discover related pathways, diseases and genes to PHF11 Antibody (NBP1-80332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF11 Antibody (NBP1-80332)

Discover more about diseases related to PHF11 Antibody (NBP1-80332).
 

Pathways for PHF11 Antibody (NBP1-80332)

View related products by pathway.

Blogs on PHF11

There are no specific blogs for PHF11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF11
Uniprot