PHF11 Antibody (1J3E4)

Western Blot: PHF11 Antibody (1J3E4) [NBP3-33467] - Western blot analysis of lysates from Mouse spleen, using [KD Validated] PHF11 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Western Blot: PHF11 Antibody (1J3E4) [NBP3-33467] - Western blot analysis of lysates from wild type(WT) and PHF11 knockdown (KD) 293T cells, using [KD Validated] PHF11 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Western Blot: PHF11 Antibody (1J3E4) [PHF11] - Western blot analysis of lysates from wild type(WT) and PHF11 knockdown (KD) 293T cells, using [KD Validated] PHF11 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1J3E4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PHF11 Antibody (1J3E4) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-321 of human PHF11 (NP_001035533.1).
  
  Sequence:
  MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PHF11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PHF11 Antibody (1J3E4)

• APY
• BCAPIGHER
• BRCA1 C-terminus-associated protein
• IgE responsiveness (atopic)
• IGEL
• IGER
• NY-REN-34 antigen
• NYREN34
• NY-REN-34
• PHD finger protein 11
• Renal carcinoma antigen NY-REN-34

Background

These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot (see Application Notes below). However no additional claims are made for their ability to recognize native protein in any application.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHF11