PHF11 Antibody (1J3E4) Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 40-321 of human PHF11 (NP_001035533.1).
Sequence: MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMS |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
PHF11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:1000 - 1:5000
|
| Theoretical MW |
38 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PHF11 Antibody (1J3E4)
Background
These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot (see Application Notes below). However no additional claims are made for their ability to recognize native protein in any application.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Ha, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Mu
Applications: Simple Western, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ChIP, ICC/IF, IP, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for PHF11 Antibody (NBP3-33467) (0)
There are no publications for PHF11 Antibody (NBP3-33467).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PHF11 Antibody (NBP3-33467) (0)
There are no reviews for PHF11 Antibody (NBP3-33467).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PHF11 Antibody (NBP3-33467) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PHF11 Products
Research Areas for PHF11 Antibody (NBP3-33467)
Find related products by research area.
|
Blogs on PHF11