PHACTR1 Antibody

Western Blot: PHACTR1 Antibody [NBP1-84232] - Analysis in control (vector only transfected HEK293T lysate) and PHACTR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: PHACTR1 Antibody [NBP1-84232] - Staining in human cerebral cortex and pancreas tissues using anti-PHACTR1 antibody. Corresponding PHACTR1 RNA-seq data are presented for the same tissues.

Western Blot: PHACTR1 Antibody [NBP1-84232] - Analysis in human cerebral cortex tissue.

Immunohistochemistry-Paraffin: PHACTR1 Antibody [NBP1-84232] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PHACTR1 Antibody [NBP1-84232] - Staining of human pancreas shows low expression as expected.

Product Discontinued

PHACTR1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PCSTSYHSSGLHSGDGVTKAGPMGLPEIRQVPTVVIECDDNKENVPHESDYEDSSCLYTREEEEEEEDEDDDSSLYTSS
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHACTR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHACTR1 Antibody

• dJ257A7.2
• KIAA1733MGC126577
• MGC126575
• phosphatase and actin regulator 1
• RPEL repeat containing 1
• RPEL
• RPEL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHACTR1 Antibody (NBP1-84232)(1)

Publication using NBP1-84232

• Kasikara C, Schilperoort M, Gerlach BD et al. Deficiency of macrophage PHACTR1 impairs efferocytosis and promotes atherosclerotic plaque necrosis The Journal of clinical investigation 2021-02-25 [PMID: 33630758] (WB)

Bioinformatics

• Gene Symbol: PHACTR1