Home » PGS1 » PGS1 Antibodies » PGS1 Antibody

PGS1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PGS1 Antibody [NBP2-88040] - WB Suggested Anti-PGS1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate
Western Blot: PGS1 Antibody [NBP2-88040] - WB Suggested Anti-PGS1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate
Immunohistochemistry: PGS1 Antibody [NBP2-88040] - Human Brain

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PGS1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PGS1. Peptide sequence: QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PGS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGS1 Antibody

  • CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  • DKFZP762M186
  • EC 2.7.8.5
  • MGC131960
  • mitochondrial
  • PGP synthase 1
  • phosphatidylglycerophosphate synthase 1DKFZp762M186

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Decorin Antibody
[Unconjugated]
AF143
Western blot shows lysates of human uterus tissue and human heart tissue. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Decorin at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human uterus and human heart tissue, loaded at 0.2 mg/mL. A specific band was detected for Decorin at approximately 140-149 kDa (as indicated) using 5 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
Decorin was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to intralobular stromal tissue. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(18 Publications)
Species: Hu
Applications: IHC, Simple Western, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(7 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
COX-1 Antibody
NBP1-85500
Immunocytochemistry/Immunofluorescence: COX-1 Antibody [NBP1-85500] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skin shows high expression.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
TPGS2 Antibody
NBP2-20687
Western Blot: TPGS2 Antibody [NBP2-20687] - Sample (30 ug of whole cell lysate) A: HCT116 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: TPGS2 Antibody [NBP2-20687] - Analysis of methanol-fixed HCT116, using antibody at 1:500 dilution.
Species: Hu
Applications: ICC/IF, WB
NAT2 Antibody
NBP1-33751
Immunohistochemistry-Paraffin: NAT2 Antibody [NBP1-33751] - A549 xenograft, using NAT2 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: NAT2 Antibody [NBP1-33751] - Sample (30 ug of whole cell lysate) A: A431 B: H1299 12% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: IHC, IHC-P, WB
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ZNF238 Antibody
NBP2-82381
Western Blot: ZNF238 Antibody [NBP2-82381] - WB Suggested Anti-ZNF238 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Pancreas
Western Blot: ZNF238 Antibody [NBP2-82381] - Host: Rabbit. Target Name: ZNF238. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: ZNF238 Antibody [NBP2-82381] - Host: Rabbit. Target Name: ZNF238. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
TAZ/WWTR1 Antibody
- BSA Free
NB110-58359
Simple Western: TAZ/WWTR1 Antibody [NB110-58359] - Simple Western lane view shows a specific band for TAZ in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ (Green) in HepG2 cells using NB110-58359. Nuclei (Blue) are counterstained with Hoecsht 33258.
Western Blot: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ on HEK 293 cell lysate using NB110-58359.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
COX IV Isoform 2
Antibody (1F2)
H00084701-M01
ELISA: COX IV Isoform 2 Antibody (1F2) [H00084701-M01] - Detection limit for recombinant GST tagged COX4I2 is 0.03 ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: COX IV Isoform 2 Antibody (1F2) [H00084701-M01] - Analysis of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Immunoprecipitation: COX IV Isoform 2 Antibody (1F2) [H00084701-M01] - Analysis of COX4I2 transfected lysate using anti-COX4I2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with COX4I2 MaxPab rabbit polyclonal antibody.
(10 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ELISA, IB, IHC, IHC-P, IP, WB
COX4 Antibody -
BSA Free
NB110-39115
Immunocytochemistry: COX4 Antibody [NB110-39115] - Analysis of methanol fixed drosophila embryo using 1:200 dilution of COX4 antibody. The signal was developed using AF488 conjugated Donkey anti-Rabbit IgG (H+L) secondary antibody and the sections were further counterstained for tubulin and DAPI. The antibody generated a specific staining of COX4 in mitochondria near mitotic spindles at early stage of embryo development. Image from verified customer review.
Western Blot: COX4 Antibody [NB110-39115] - Total protein from HeLa, 3T3 and PC12 was separated on a 4-20% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/mL anti-COX4 in 5% block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: COX4 Antibody [NB110-39115] - NIH3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-COX4 at 10 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(4 Reviews)
(11 Publications)
Species: Bv, Dr, Hu, I, Mu, Ma-Op, Po, Pm, Rt
Applications: ChIP, ICC, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Species: Hu, Mu
Applications: WB
CPOX Antibody
(36B10) - BSA Free
NBP2-59438
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
MKLP1 Antibody
(SY02-74)
NBP2-67446
Immunocytochemistry/Immunofluorescence: MKLP1 Antibody (SY02-74) [NBP2-67446] - Staining MKLP1 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: MKLP1 Antibody (SY02-74) [NBP2-67446] - Staining MKLP1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Western Blot: MKLP1 Antibody (SY02-74) [NBP2-67446] - Analysis of MKLP1 on different lysates using anti-MKLP1 antibody at 1/1,000 dilution. Positive control: Lane 1: A549 Lane 2: Hela
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
GOLPH3 Antibody
NBP2-75515
Flow Cytometry: GOLPH3 Antibody [NBP2-75515] - Analysis of Hela cells with GOLPH3 antibody at 1/100 dilution (green) compared with an unlabelled control (cells without incubation with primary antibody; red).
Immunocytochemistry/Immunofluorescence: GOLPH3 Antibody [NBP2-75515] - Staining GOLPH3 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: GOLPH3 Antibody [NBP2-75515] - Staining GOLPH3 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB

Publications for PGS1 Antibody (NBP2-88040) (0)

There are no publications for PGS1 Antibody (NBP2-88040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGS1 Antibody (NBP2-88040) (0)

There are no reviews for PGS1 Antibody (NBP2-88040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGS1 Antibody (NBP2-88040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGS1 Products

Bioinformatics Tool for PGS1 Antibody (NBP2-88040)

Discover related pathways, diseases and genes to PGS1 Antibody (NBP2-88040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGS1 Antibody (NBP2-88040)

Discover more about diseases related to PGS1 Antibody (NBP2-88040).
 

Pathways for PGS1 Antibody (NBP2-88040)

View related products by pathway.

PTMs for PGS1 Antibody (NBP2-88040)

Learn more about PTMs related to PGS1 Antibody (NBP2-88040).
 

Research Areas for PGS1 Antibody (NBP2-88040)

Find related products by research area.

Blogs on PGS1

There are no specific blogs for PGS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGS1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PGS1