PGS1 Antibody

Images

 
Western Blot: PGS1 Antibody [NBP2-88040] - WB Suggested Anti-PGS1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate
Immunohistochemistry: PGS1 Antibody [NBP2-88040] - Human Brain

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGS1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PGS1. Peptide sequence: QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PGS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGS1 Antibody

  • CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  • DKFZP762M186
  • EC 2.7.8.5
  • MGC131960
  • mitochondrial
  • PGP synthase 1
  • phosphatidylglycerophosphate synthase 1DKFZp762M186

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
AF143
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-20687
Species: Hu
Applications: ICC/IF, WB
NBP1-33751
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82381
Species: Hu
Applications: WB
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
H00084701-M01
Species: Bv, Hu, Mu, Rt
Applications: ELISA, IB, IHC, IHC-P, IP, WB
NB110-39115
Species: Bv, Dr, Hu, I, Mu, Ma-Op, Po, Pm, Rt
Applications: ChIP, ICC, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
H00008398-D01P
Species: Hu, Mu
Applications: WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-67446
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB

Publications for PGS1 Antibody (NBP2-88040) (0)

There are no publications for PGS1 Antibody (NBP2-88040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGS1 Antibody (NBP2-88040) (0)

There are no reviews for PGS1 Antibody (NBP2-88040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGS1 Antibody (NBP2-88040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGS1 Products

Bioinformatics Tool for PGS1 Antibody (NBP2-88040)

Discover related pathways, diseases and genes to PGS1 Antibody (NBP2-88040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGS1 Antibody (NBP2-88040)

Discover more about diseases related to PGS1 Antibody (NBP2-88040).
 

Pathways for PGS1 Antibody (NBP2-88040)

View related products by pathway.

PTMs for PGS1 Antibody (NBP2-88040)

Learn more about PTMs related to PGS1 Antibody (NBP2-88040).
 

Research Areas for PGS1 Antibody (NBP2-88040)

Find related products by research area.

Blogs on PGS1

There are no specific blogs for PGS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGS1