Recombinant Human PGAP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PGAP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 168-266 of Human PGAP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PGAP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PGAP1 Protein

  • Bst1
  • EC 3.1
  • FLJ12377
  • FLJ42774
  • GPI deacylase
  • GPI inositol-deacylase
  • hPGAP1
  • ISPD3024
  • post-GPI attachment to proteins 1
  • Post-GPI attachment to proteins factor 1

Background

PGAP1 - GPI deacylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-87001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39015
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32398
Species: Hu
Applications: IHC, IHC-P
NBP1-86474
Species: Hu
Applications: IHC, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00080055-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PGAP1 Partial Recombinant Protein (H00080055-Q01) (0)

There are no publications for PGAP1 Partial Recombinant Protein (H00080055-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGAP1 Partial Recombinant Protein (H00080055-Q01) (0)

There are no reviews for PGAP1 Partial Recombinant Protein (H00080055-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGAP1 Partial Recombinant Protein (H00080055-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGAP1 Products

Bioinformatics Tool for PGAP1 Partial Recombinant Protein (H00080055-Q01)

Discover related pathways, diseases and genes to PGAP1 Partial Recombinant Protein (H00080055-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGAP1 Partial Recombinant Protein (H00080055-Q01)

Discover more about diseases related to PGAP1 Partial Recombinant Protein (H00080055-Q01).
 

Pathways for PGAP1 Partial Recombinant Protein (H00080055-Q01)

View related products by pathway.

PTMs for PGAP1 Partial Recombinant Protein (H00080055-Q01)

Learn more about PTMs related to PGAP1 Partial Recombinant Protein (H00080055-Q01).

Blogs on PGAP1

There are no specific blogs for PGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LRRK2 Antibody
NB300-268
PGAP1 Antibody
NBP2-38121

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PGAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PGAP1