PGAM5 Antibody

Product Discontinued

PGAM5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PGAM5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PGAM5 Antibody

• Bcl-XL-binding protein v68
• BXLBv68
• EC 3.1.3.16
• MGC5352
• phosphoglycerate mutase family member 5BXLBV68
• serine/threonine-protein phosphatase PGAM5, mitochondrial

Background

Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate fora Keap1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PGAM5