We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PEX19 Recombinant Protein Antigen

Images

 
There are currently no images for PEX19 Protein (NBP1-92255PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PEX19 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX19.

Source: E. coli

Amino Acid Sequence: SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEX19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92255.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PEX19 Recombinant Protein Antigen

  • D1S2223Ehousekeeping gene, 33kD
  • HK3333 kDa housekeeping protein
  • Peroxin-19
  • peroxisomal biogenesis factor 19
  • Peroxisomal farnesylated proteinFLJ55296
  • PMP1
  • PMPI
  • PXFperoxin-19
  • PXMP1

Background

PEX19 is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-18138
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-87258
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, KO, WB
8090-ZN
Species: Hu
Applications: EnzAct
NBP2-94643
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-85828
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-86321
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33435
Species: Hu
Applications: WB
NBP1-57578
Species: Hu
Applications: WB
NBP3-46842
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-41265
Species: Hu, Po
Applications: IHC,  IHC-P, WB
NB100-65676
Species: Hu
Applications: ELISA, IHC, IHC-Fr,  IHC-P
H00008800-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-22409
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
NBP1-80967
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P

Publications for PEX19 Protein (NBP1-92255PEP) (0)

There are no publications for PEX19 Protein (NBP1-92255PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX19 Protein (NBP1-92255PEP) (0)

There are no reviews for PEX19 Protein (NBP1-92255PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEX19 Protein (NBP1-92255PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX19 Products

Research Areas for PEX19 Protein (NBP1-92255PEP)

Find related products by research area.

Blogs on PEX19

There are no specific blogs for PEX19, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PEX19 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX19