PEX19 Antibody

Images

 
Western Blot: PEX19 Antibody [H00005824-B02P] - Analysis of PEX19 expression in human liver.
Western Blot: PEX19 Antibody [H00005824-B02P] - Analysis of PEX19 expression in transfected 293T cell line by PEX19 polyclonal antibody. Lane 1: PEX19 transfected lysate(33 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PEX19 Antibody Summary

Immunogen
PEX19 (AAH00496.1, 1 a.a. - 299 a.a.) full-length human protein. MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQGIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDAPNLSGPPGASGEQCLIM
Specificity
Reacts with peroxisomal biogenesis factor 19.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PEX19
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PEX19 Antibody

  • D1S2223Ehousekeeping gene, 33kD
  • HK3333 kDa housekeeping protein
  • Peroxin-19
  • peroxisomal biogenesis factor 19
  • Peroxisomal farnesylated proteinFLJ55296
  • PMP1
  • PMPI
  • PXFperoxin-19
  • PXMP1

Background

This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33556
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46476
Species: Hu
Applications: WB, IHC
8090-ZN
Species: Hu
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33435
Species: Hu
Applications: WB
NBP1-57578
Species: Hu
Applications: WB
NBL1-15012
Species: Hu
NBP1-84311
Species: Hu
Applications: IHC, IHC-P
NBP2-35213
Species: Hu
NBP1-59704
Species: Hu
Applications: WB
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84312
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC

Publications for PEX19 Antibody (H00005824-B02P) (0)

There are no publications for PEX19 Antibody (H00005824-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX19 Antibody (H00005824-B02P) (0)

There are no reviews for PEX19 Antibody (H00005824-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX19 Antibody (H00005824-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX19 Products

Bioinformatics Tool for PEX19 Antibody (H00005824-B02P)

Discover related pathways, diseases and genes to PEX19 Antibody (H00005824-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX19 Antibody (H00005824-B02P)

Discover more about diseases related to PEX19 Antibody (H00005824-B02P).
 

Pathways for PEX19 Antibody (H00005824-B02P)

View related products by pathway.

PTMs for PEX19 Antibody (H00005824-B02P)

Learn more about PTMs related to PEX19 Antibody (H00005824-B02P).

Blogs on PEX19

There are no specific blogs for PEX19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX19
Entrez
Uniprot