Home » PEX13 » PEX13 Proteins » PEX13 Recombinant Protein Antigen

PEX13 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PEX13 Protein (NBP1-86321PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

PEX13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX13.

Source: E.coli

Amino Acid Sequence: SADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGA
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEX13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86321.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PEX13 Recombinant Protein Antigen

  • NALD
  • peroxin-13
  • peroxisomal biogenesis factor 13
  • peroxisomal membrane protein PEX13
  • peroxisome biogenesis factor 13
  • ZWS

Background

PEX13 is a component of the peroxisomal translocation machinery with PEX14 and PEX17. It functions as a docking factor for the predominantly cytoplasmnic PTS1 receptor. It is also involved in the import of PTS1 and PTS2 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PEX14 Antibody
NBP2-33455
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human liver shows moderate cytoplasmic granular positivity in hepatocytes.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PEX7 Antibody
NBP1-57578
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
(1 Publication)
Species: Hu
Applications: WB
PEX5 Antibody
NBP1-87185
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human lymph node using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ABCD1 Antibody
(OTI2C12)
NBP2-46476
Knockdown Validated: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Western blot shows lysates of TIME human endothelial parental cell line and ABCD1 knockout (KO) TIME cell line. PVDF membrane was probed with 1:2000 of Mouse Anti-Human ABCD1 Monoclonal Antibody (Catalog # NBP2-46476) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for ABCD1 at approximately 75 kDa (as indicated) in the parental TIME cell line, but is not detectable in the knockout TIME cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Analysis of Carcinoma of Human lung tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, KD, KO, WB
PHEX
8090-ZN
PHEX
Species: Hu
Applications: EnzAct
PEX12 Antibody
NBP2-49599
Western Blot: PEX12 Antibody [NBP2-49599] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining of human bone marrow shows low expression as expected.
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining in human epididymis and bone marrow tissues using anti-PEX12 antibody. Corresponding PEX12 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
PXMP3 Antibody
NBP2-94643
Western Blot: PXMP3 Antibody [NBP2-94643] - Analysis of extracts of various cell lines, using PXMP3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 20s.
Immunohistochemistry-Paraffin: PXMP3 Antibody [NBP2-94643] - Immunohistochemistry of paraffin-embedded human placenta using PXMP3 Rabbit pAb (NBP2-94643) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PEX19 Antibody
NBP1-32925
Western Blot: PEX19 Antibody [NBP1-32925] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with PEX19 antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: PEX19 Antibody [NBP1-32925] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with PEX19 antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301 was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PEX19 Antibody [NBP1-32925] - Methanol-fixed HeLa antibody (Green) at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PEX10 Antibody -
BSA Free
NBP3-18137
Western Blot: PEX10 Antibody - BSA Free [NBP3-18137] - WB Validation in Human and Mouse Cell Lines. Loading: 15 ug of lysate Antibodies: PEX10 NBP3-18137, 4 ug/mL , 1 h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjugate at 1:10,000 dilution.
Western Blot: PEX10 Antibody - BSA Free [NBP3-18137] - WB Validation in Mouse Tissues. Loading: 15 ug of lysates per lane. Antibodies: PEX10 NBP3-18137, 4 ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10,000 dilution.
Western Blot: PEX10 Antibody - BSA Free [NBP3-18137] - WB Validation in Rat Tissues. Loading: 15 ug of lysates per lane. Antibodies: PEX10 NBP3-18137, 4 ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10,000 dilution.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
PEX1 Antibody
NBP1-80577
Western Blot: PEX1 Antibody [NBP1-80577] - Analysis in human cell line AN3-CA.
Immunocytochemistry/Immunofluorescence: PEX1 Antibody [NBP1-80577] - Staining of human cell line A-431 shows positivity in vesicles. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
ZNF260 Antibody
NBP1-80967
Immunohistochemistry-Paraffin: ZNF260 Antibody [NBP1-80967] - Staining of human stomach shows strong nuclear and additional cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ZNF260 Antibody [NBP1-80967] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
PEX6 Antibody
NBP1-80955
Western Blot: PEX6 Antibody [NBP1-80955] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding PEX6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PEX3 Antibody
NBP1-86210
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human adrenal gland shows strong granular cytoplasm positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human kidney shows strong granular cytoplasm positivity in cells in tubules.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
PTS Antibody
NBP1-32975
Western Blot: PTS Antibody [NBP1-32975] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with PTS antibody diluted at 1:5000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: PTS Antibody [NBP1-32975] - Wild-type (WT) and PTS knockout (KO) HeLa cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with PTS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PTS Antibody [NBP1-32975] - Analysis of methanol-fixed HeLa, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Holo-Transferrin
2914-HT
Holo-Transferrin
(37 Publications)
Species: Hu
Applications: BA
Recombinant Human
PEX11A GST (N-Term) P ...
H00008800-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for PEX13 Protein (NBP1-86321PEP) (0)

There are no publications for PEX13 Protein (NBP1-86321PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX13 Protein (NBP1-86321PEP) (0)

There are no reviews for PEX13 Protein (NBP1-86321PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEX13 Protein (NBP1-86321PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX13 Products

Bioinformatics Tool for PEX13 Protein (NBP1-86321PEP)

Discover related pathways, diseases and genes to PEX13 Protein (NBP1-86321PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX13 Protein (NBP1-86321PEP)

Discover more about diseases related to PEX13 Protein (NBP1-86321PEP).
 

Pathways for PEX13 Protein (NBP1-86321PEP)

View related products by pathway.

PTMs for PEX13 Protein (NBP1-86321PEP)

Learn more about PTMs related to PEX13 Protein (NBP1-86321PEP).

Blogs on PEX13

There are no specific blogs for PEX13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PEX13 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PEX13