Pet1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pet1 Antibody [NBP2-55967] - Staining of human cell line SH-SY5Y shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pet1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FEV
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pet1 Recombinant Protein Antigen (NBP2-55967PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Pet1 Antibody

  • FEV (ETS oncogene family)
  • FEV (fifth Ewing variant)
  • Fifth Ewing variant protein
  • HSRNAFEV
  • PC12 ETS domain-containing transcription factor 1
  • PC12 ETS factor 1
  • PET1
  • Pet-1
  • protein FEV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-04611
Species: Hu
NBP2-56927
Species: Hu
Applications: ICC/IF

Publications for Pet1 Antibody (NBP2-55967) (0)

There are no publications for Pet1 Antibody (NBP2-55967).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pet1 Antibody (NBP2-55967) (0)

There are no reviews for Pet1 Antibody (NBP2-55967). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pet1 Antibody (NBP2-55967) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pet1 Products

Bioinformatics Tool for Pet1 Antibody (NBP2-55967)

Discover related pathways, diseases and genes to Pet1 Antibody (NBP2-55967). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pet1 Antibody (NBP2-55967)

Discover more about diseases related to Pet1 Antibody (NBP2-55967).
 

Pathways for Pet1 Antibody (NBP2-55967)

View related products by pathway.

PTMs for Pet1 Antibody (NBP2-55967)

Learn more about PTMs related to Pet1 Antibody (NBP2-55967).

Blogs on Pet1

There are no specific blogs for Pet1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pet1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FEV