PEMT Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse PEMT (NP_001276940.1). Peptide sequence NPMYWGSTANYLGWALMHASPTGLLLTVLVAIVYVVALLYEEPFTAEIYR |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PEMT |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PEMT Antibody - BSA Free
Background
PEMT also known as Phosphatidylethanolamine N-methyltransferase, has 3 isoforms, a 199 amino acid isoform that is 22 kDa, a 236 amino acid that is 26 kDa, and 232 amino acid isoform that is 25 kDa, converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver and localizes to the endoplasmic reticulum and mitochondria-associated membranes. This protein is being studied for its involvement in ceroid lipofuscinosis, neuronal ceroid-lipofuscinosis, smith-magenis syndrome, spina bifida, orofacial cleft, whiplash, fatty liver disease, liver disease, cystic fibrosis, hepatocellular carcinoma, Alzheimer's disease, gigantism, breast cancer, liver cancer, homocysteine, fibrosis, alcoholism, endometriosis, gastric cancer, and infertility. The protein has been linked to the glycerophospholipid biosynthesis, metabolism, phospholipid metabolism, synthesis of PC, metabolism of lipids and lipoproteins, acetylcholine synthesis, and acetylcholine synthesis pathways where it interacts with CALM1, CALM2, CALM3, ALG5, ALG6, ALG8, EMC3, FEN1, and over 180 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for PEMT Antibody (NBP3-11004) (0)
There are no publications for PEMT Antibody (NBP3-11004).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PEMT Antibody (NBP3-11004) (0)
There are no reviews for PEMT Antibody (NBP3-11004).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PEMT Antibody (NBP3-11004) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PEMT Products
Blogs on PEMT