PEBP4 Antibody - Azide and BSA Free

Western Blot: PEBP4 Antibody [NBP2-94404] - Analysis of extracts of mouse lung, using PEBP4 .Exposure time: 30s.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PEBP4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PEBP4 Antibody - Azide and BSA Free (NBP2-94404) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human PEBP4 (NP_659399.2). DEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEBP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:1000
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PEBP4 Antibody - Azide and BSA Free

• CORK-1
• CORK1GWTM1933
• cousin-of-RKIP 1 protein
• hPEBP4PRO4408
• MGC22776
• PEBP-4
• PEPB4
• phosphatidylethanolamine-binding protein 4
• Protein cousin-of-RKIP 1

Background

The phosphatidylethanolamine (PE)-binding proteins, including PEBP4, are an evolutionarily conserved family of proteins with pivotal biologic functions, such as lipid binding and inhibition of serine proteases (Wang et al., 2004 [PubMed 15302887]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PEBP4