PDE8A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PDE8A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE8A.
  
  

  Source: E. coli

  Amino Acid Sequence: TTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSLDVKAVASRATEVSSQRRHSS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PDE8A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83160.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE8A Recombinant Protein Antigen

• cAMP-specific cyclic nucleotide phosphodiesterase 8A
• EC 3.1.4.17
• FLJ16150
• high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
• high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
• HsT19550
• PDE8A
• phosphodiesterase 8A

Background

Phosphodiesterase type 8 (PDE8) is one of the many phosphodiesterases that compartmentalize and hydrolyze cAMP into AMP. The cAMP-specific PDE8 family is comprised of 2 genes (PDE8A and PDE8B) each with multiple splice variants generated by RNA splicing and use of alternate initiation sites. PDE8 family is a high affinity cAMP-specific, IBMX sensitive PDE. PDE8 has a significant conserved region of about 270 amino acids common to all PDEs at the carboxy terminal apparently serves as the catalytic domain. The amino-terminal region of this protein is divergent and presumably accounts for the distinctive and regulatory properties unique to the individual PDE families. PDE8A protein showed significant homology to other cAMP-dependent PDEs (23%) within the catalytic domain. PDE8A is widely expressed in various tissues in contrast to PDE8B that is exclusively expressed in thyroid gland. The PDE8A transcripts are found in brain, pancreas, placenta, thyroid, spleen, trachea, prostate, and uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PDE8A