Recombinant Human PDE8A GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 32-121 of Human PDE8A Source: Wheat Germ (in vitro) Amino Acid Sequence: RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
PDE8A |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
35.64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human PDE8A GST (N-Term) Protein
Background
Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000). See MIM 171885.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP
Publications for PDE8A Partial Recombinant Protein (H00005151-Q01) (0)
There are no publications for PDE8A Partial Recombinant Protein (H00005151-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PDE8A Partial Recombinant Protein (H00005151-Q01) (0)
There are no reviews for PDE8A Partial Recombinant Protein (H00005151-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PDE8A Partial Recombinant Protein (H00005151-Q01) (0)
Additional PDE8A Products
Research Areas for PDE8A Partial Recombinant Protein (H00005151-Q01)
Find related products by research area.
|
Blogs on PDE8A