PDE6A Recombinant Protein Antigen

Images

 
There are currently no images for PDE6A Recombinant Protein Antigen (NBP2-68985PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDE6A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE6A.

Source: E.coli

Amino Acid Sequence: EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM

Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDE6A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68985. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE6A Recombinant Protein Antigen

  • CGPR-A
  • EC 3.1.4
  • EC 3.1.4.35
  • GMP-PDE alpha
  • PDE V-B1
  • PDEAcGMP phosphodiesterase alpha subunit
  • phosphodiesterase 6A, cGMP-specific, rod, alpha
  • rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit alpha
  • rod photoreceptor cGMP phosphodiesterase alpha subunit
  • RP43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00005146-Q01
Species: Hu
NBP1-84412
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01353
Species: Hu
Applications: WB, IHC, IHC-P
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IF
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-90038
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
AF2945
Species: Hu
Applications: WB
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82549
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-68985PEP
Species: Hu
Applications: AC

Publications for PDE6A Recombinant Protein Antigen (NBP2-68985PEP) (0)

There are no publications for PDE6A Recombinant Protein Antigen (NBP2-68985PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE6A Recombinant Protein Antigen (NBP2-68985PEP) (0)

There are no reviews for PDE6A Recombinant Protein Antigen (NBP2-68985PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PDE6A Recombinant Protein Antigen (NBP2-68985PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PDE6A Recombinant Protein Antigen (NBP2-68985PEP)

Discover related pathways, diseases and genes to PDE6A Recombinant Protein Antigen (NBP2-68985PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE6A Recombinant Protein Antigen (NBP2-68985PEP)

Discover more about diseases related to PDE6A Recombinant Protein Antigen (NBP2-68985PEP).
 

Pathways for PDE6A Recombinant Protein Antigen (NBP2-68985PEP)

View related products by pathway.

Research Areas for PDE6A Recombinant Protein Antigen (NBP2-68985PEP)

Find related products by research area.

Blogs on PDE6A

There are no specific blogs for PDE6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDE6A Antibody
NBP1-87312

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDE6A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE6A