PDE1B Antibody (5B6)

Images

 
Sandwich ELISA: PDE1B Antibody (5B6) [H00005153-M01] - Detection limit for recombinant GST tagged PDE1B is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDE1B Antibody (5B6) Summary

Immunogen
PDE1B (AAH32226 437 a.a. - 536 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Localization
Cytoplasmic
Specificity
PDE1B - phosphodiesterase 1B, calmodulin-dependent
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDE1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00005153-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE1B Antibody (5B6)

  • 63 kDa Cam-PDE
  • calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1B
  • Cam-PDE 1B
  • EC 3.1.4
  • EC 3.1.4.17
  • PDE1B1calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase
  • PDES1Bcalmodulin-stimulated phosphodiesterase PDE1B1
  • phosphodiesterase 1B, calmodulin-dependent
  • phosphodiesterase IB, calmodulin-dependent
  • Phosphodiesterase-1B
  • presumed 63kDa form of the type 1 cyclic nucleotide phosphodiesterase familyknown as PDE1B

Background

PDE1B, a variant of PDE1, is a Ca2+-calmodulin-stimulated phosphodieterase (PDE) preferentially hydrolyzing cGMP. Cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodieterases. In mammals at least 11 different families of PDEs can be discriminated (PDE1-11) based on their kinetic properties and inhibition to various pharmacological agents. Three different PDE1 genes have been identified (PDE1A, PDE1B, PDE1C). The enzymes of the PDE1A and PDE1B have higher affinity for cGMP than for cAMP, whereas PDE1C has high affinity for both cAMP and cGMP. Calcium-Calmodulin stimulates the activity of each of these enzymes several-fold. The tissue distribution of PDE1B is different from other PDE1 gene family members. In testis PDE1B is expressed uniformly through out the seminiferous epithelium and in the interstistium in contrast to PDE1A and PDE1C that is expressed in elongated to mature spermatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46355
Species: Hu
Applications: WB, IHC
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-43333
Species: Mu
Applications: WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-655
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-40453
Species: Hu, Bt, Bv, Ca, Mk, Pm, Rb, Xp
Applications: IHC, IHC-P
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-234
Species: Hu, Mu, Rt
Applications: WB
6507-IL/CF
Species: Hu
7954-GM/CF
Species: Hu
NBP1-32341
Species: Hu
Applications: WB, IHC, IHC-P
7954-GM/CF
Species: Hu

Publications for PDE1B Antibody (H00005153-M01)(1)

Reviews for PDE1B Antibody (H00005153-M01) (0)

There are no reviews for PDE1B Antibody (H00005153-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE1B Antibody (H00005153-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PDE1B Products

Bioinformatics Tool for PDE1B Antibody (H00005153-M01)

Discover related pathways, diseases and genes to PDE1B Antibody (H00005153-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE1B Antibody (H00005153-M01)

Discover more about diseases related to PDE1B Antibody (H00005153-M01).
 

Pathways for PDE1B Antibody (H00005153-M01)

View related products by pathway.

PTMs for PDE1B Antibody (H00005153-M01)

Learn more about PTMs related to PDE1B Antibody (H00005153-M01).
 

Research Areas for PDE1B Antibody (H00005153-M01)

Find related products by research area.

Blogs on PDE1B

There are no specific blogs for PDE1B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE1B Antibody (5B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE1B
Entrez
OMIM
Uniprot