PDE1B Antibody (5B6) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
PDE1B (AAH32226, 437 a.a. ~ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD |
| Localization |
Cytoplasmic |
| Specificity |
PDE1B - phosphodiesterase 1B, calmodulin-dependent |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
PDE1B |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PDE1B Antibody (5B6) - Azide and BSA Free
Background
PDE1B, a variant of PDE1, is a Ca2+-calmodulin-stimulated phosphodieterase (PDE) preferentially hydrolyzing cGMP.
Cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodieterases. In mammals at least 11 different families of PDEs can be discriminated (PDE1-11) based on their kinetic properties and inhibition to various pharmacological agents. Three different PDE1 genes have been identified (PDE1A, PDE1B, PDE1C). The enzymes of the PDE1A and PDE1B have higher affinity for cGMP than for cAMP, whereas PDE1C has high affinity for both cAMP and cGMP. Calcium-Calmodulin stimulates the activity of each of these enzymes several-fold. The tissue distribution of PDE1B is different from other PDE1 gene family members. In testis PDE1B is expressed uniformly through out the seminiferous epithelium and in the interstistium in contrast to PDE1A and PDE1C that is expressed in elongated to mature spermatids.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Publications for PDE1B Antibody (H00005153-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for PDE1B Antibody (H00005153-M01) (0)
There are no reviews for PDE1B Antibody (H00005153-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PDE1B Antibody (H00005153-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PDE1B Products
Research Areas for PDE1B Antibody (H00005153-M01)
Find related products by research area.
|
Blogs on PDE1B