PD-ECGF/Thymidine Phosphorylase Antibody

Images

 
Western Blot: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PD-ECGF/Thymidine Phosphorylase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TYMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PD-ECGF/Thymidine Phosphorylase Protein (NBP1-84916PEP)
Publications
Read Publication using
NBP1-84916 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26623038).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PD-ECGF/Thymidine Phosphorylase Antibody

  • dThdPase
  • EC 2.4.2
  • EC 2.4.2.4
  • ECGF
  • ECGF1
  • ECGF1TP
  • endothelial cell growth factor 1 (platelet-derived)
  • Gliostatin
  • hPD-ECGF
  • MEDPS1
  • MNGIE
  • MTDPS1
  • PDECGF
  • PD-ECGF
  • Platelet-derived endothelial cell growth factor
  • TdRPase
  • Thymidine Phosphorylase
  • TPase
  • TYMP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
MAB5170
Species: Hu
Applications: WB, Simple Western, Block
NBP1-85896
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2009
Species: Hu
Applications: WB, IHC
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4779
Species: Hu
Applications: WB, IHC
NBP1-84916
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916) (0)

There are no reviews for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PD-ECGF/Thymidine Phosphorylase Products

Bioinformatics Tool for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916)

Discover related pathways, diseases and genes to PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916)

Discover more about diseases related to PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916).
 

Pathways for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916)

View related products by pathway.

PTMs for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916)

Learn more about PTMs related to PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916).
 

Research Areas for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916)

Find related products by research area.

Blogs on PD-ECGF/Thymidine Phosphorylase

There are no specific blogs for PD-ECGF/Thymidine Phosphorylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PD-ECGF/Thymidine Phosphorylase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TYMP
Entrez
Uniprot