Recombinant Human PCTP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCTP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-214 of Human PCTP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT

Protein/Peptide Type
Recombinant Protein
Gene
PCTP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCTP Protein

  • PC-TP
  • phosphatidylcholine transfer protein
  • StARD2
  • STARD2StAR-related lipid transfer (START) domain containing 2
  • StAR-related lipid transfer protein 2
  • START domain-containing protein 2

Background

PCTP( AAH12084, 1 a.a. - 215 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4538
Species: Hu, Mu, Rt
Applications: WB
MAB4218
Species: Hu
Applications: WB, IHC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-106
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-34132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCTP Recombinant Protein (H00058488-P01) (0)

There are no publications for PCTP Recombinant Protein (H00058488-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTP Recombinant Protein (H00058488-P01) (0)

There are no reviews for PCTP Recombinant Protein (H00058488-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCTP Recombinant Protein (H00058488-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCTP Products

Bioinformatics Tool for PCTP Recombinant Protein (H00058488-P01)

Discover related pathways, diseases and genes to PCTP Recombinant Protein (H00058488-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTP Recombinant Protein (H00058488-P01)

Discover more about diseases related to PCTP Recombinant Protein (H00058488-P01).
 

Pathways for PCTP Recombinant Protein (H00058488-P01)

View related products by pathway.

PTMs for PCTP Recombinant Protein (H00058488-P01)

Learn more about PTMs related to PCTP Recombinant Protein (H00058488-P01).

Blogs on PCTP

There are no specific blogs for PCTP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PCTP Antibody
NBP2-13742

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCTP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCTP