Recombinant Human PCTAIRE2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PCTAIRE2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 426-523 of Human PCTAIRE2

Source: Wheat Germ

Amino Acid Sequence: NFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDK17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCTAIRE2 Protein

  • Cell division protein kinase 17
  • cyclin-dependent kinase 17
  • EC 2.7.11
  • EC 2.7.11.22
  • PCTAIRE protein kinase 2
  • PCTAIRE2
  • PCTAIRE-motif protein kinase 2
  • PCTK2
  • protein kinase cdc2-related PCTAIRE-2
  • Serine/threonine-protein kinase PCTAIRE-2

Background

PCTK2 - PCTAIRE protein kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91445
Species: Hu
Applications: WB
H00023415-R03
Species: Hu
AF6879
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00091768-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-30594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005128-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01) (0)

There are no publications for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01) (0)

There are no reviews for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCTAIRE2 Products

Bioinformatics Tool for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

Discover related pathways, diseases and genes to PCTAIRE2 Partial Recombinant Protein (H00005128-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

Discover more about diseases related to PCTAIRE2 Partial Recombinant Protein (H00005128-Q01).
 

Pathways for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

View related products by pathway.

Research Areas for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

Find related products by research area.

Blogs on PCTAIRE2

There are no specific blogs for PCTAIRE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCTAIRE2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK17