Recombinant Human PCTAIRE2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCTAIRE2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 426 - 523 of Human PCTK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDK17

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCTAIRE2 Protein

  • Cell division protein kinase 17
  • cyclin-dependent kinase 17
  • EC 2.7.11
  • EC 2.7.11.22
  • PCTAIRE protein kinase 2
  • PCTAIRE2
  • PCTAIRE-motif protein kinase 2
  • PCTK2
  • protein kinase cdc2-related PCTAIRE-2
  • Serine/threonine-protein kinase PCTAIRE-2

Background

PCTK2 - PCTAIRE protein kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91445
Species: Hu
Applications: WB
H00023415-R03
Species: Hu
AF6879
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56016
Species: Hu
Applications: WB, ICC/IF
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-30594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005128-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01) (0)

There are no publications for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01) (0)

There are no reviews for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCTAIRE2 Products

Bioinformatics Tool for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

Discover related pathways, diseases and genes to PCTAIRE2 Partial Recombinant Protein (H00005128-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

Discover more about diseases related to PCTAIRE2 Partial Recombinant Protein (H00005128-Q01).
 

Pathways for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

View related products by pathway.

Research Areas for PCTAIRE2 Partial Recombinant Protein (H00005128-Q01)

Find related products by research area.

Blogs on PCTAIRE2

There are no specific blogs for PCTAIRE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCTAIRE2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK17