PCF11 Antibody (3G4) - Azide and BSA Free

Sandwich ELISA: PCF11 Antibody (3G4) [H00051585-M04] - Detection limit for recombinant GST tagged PCF11 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PCF11 Antibody (3G4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PCF11 Antibody (3G4) - Azide and BSA Free (H00051585-M04) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PCF11 (NP_056969.2, 1465 a.a. ~ 1555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PCF11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCF11 Antibody (3G4) - Azide and BSA Free

• KIAA0824
• KIAA0824PCF11p homolog
• PCF11
• PCF11, cleavage and polyadenylation factor II subunit, homolog (S. cerevisiae)
• PCF11, cleavage and polyadenylation factor II subunit, homolog
• PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)
• pre-mRNA cleavage complex 2 protein Pcf11
• Pre-mRNA cleavage complex II protein Pcf11

Background

PCF11 is a component of pre-mRNA cleavage complex II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCF11
• Uniprot:
  • NP_056969(Human)