PCDHA8 Antibody


Immunohistochemistry-Paraffin: PCDHA8 Antibody [NBP1-86195] Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PCDHA8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PCLPPDLGSVDVGEEQDLNVDHGLKVSPFKFRTHKFYLWKL
Specificity of human PCDHA8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PCDHA8 Protein (NBP1-86195PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PCDHA8 Antibody

  • KIAA0345-like 6
  • PCDH-alpha-8
  • protocadherin alpha 8
  • protocadherin alpha-8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for PCDHA8 Antibody (NBP1-86195) (0)

There are no publications for PCDHA8 Antibody (NBP1-86195).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHA8 Antibody (NBP1-86195) (0)

There are no reviews for PCDHA8 Antibody (NBP1-86195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PCDHA8 Antibody (NBP1-86195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCDHA8 Products

Bioinformatics Tool for PCDHA8 Antibody (NBP1-86195)

Discover related pathways, diseases and genes to PCDHA8 Antibody (NBP1-86195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDHA8 Antibody (NBP1-86195)

Discover more about diseases related to PCDHA8 Antibody (NBP1-86195).

Pathways for PCDHA8 Antibody (NBP1-86195)

View related products by pathway.

PTMs for PCDHA8 Antibody (NBP1-86195)

Learn more about PTMs related to PCDHA8 Antibody (NBP1-86195).

Blogs on PCDHA8

There are no specific blogs for PCDHA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCDHA8 Antibody and receive a gift card or discount.


Gene Symbol PCDHA8