![Immunocytochemistry/Immunofluorescence: PCDH20 Antibody [NBP2-68793] - Staining of human cell line SH-SY5Y shows localization to vesicles.](http://images.novusbio.com/fullsize/PCDH20-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-68793-img0001.jpg "Immunocytochemistry/Immunofluorescence: PCDH20 Antibody [NBP2-68793] - Staining of human cell line SH-SY5Y shows localization to vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit PCDH20 Antibody - BSA Free (NBP2-68793) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PCDH20 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Protocadherin-10 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Protocadherin-10 [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for PCDH20 Antibody (NBP2-68793)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PCDH20 |
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Chromatin_Immunoprecipitation_11225.jpg)
![Western Blot Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Western_Blot_17168.jpg)
![Immunocytochemistry Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Immunocytochemistry__Immunofluorescence_17807.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")