PCCB Antibody - BSA Free

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85887] - Staining of human tonsil using Anti-PCCB antibody NBP1-85887.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85887] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85887] - Staining in human liver and tonsil tissues using anti-PCCB antibody. Corresponding PCCB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85887] - Staining of human kidney, liver, salivary gland and tonsil using Anti-PCCB antibody NBP1-85887 (A) shows similar protein distribution across tissues to independent antibody NBP1-85886 (B).

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85887] - Staining of human salivary gland.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85887] - Staining of human kidney.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85887] - Staining of human liver using Anti-PCCB antibody NBP1-85887.

Staining of human tonsil shows low expression as expected.

Analysis using Anti-PCCB antibody NBP1-85887 (A) shows similar pattern to independent antibody NBP1-85886 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCCB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PCCB Antibody - BSA Free (NBP1-85887) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSV
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCCB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PCCB Protein (NBP1-85887PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PCCB Antibody - BSA Free

• beta polypeptide
• mitochondrial
• propionyl CoA carboxylase, beta polypeptide

Background

PCCB is encoded by this gene is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. This gene encodes the beta subunit of PCC. Defects in this gene are a cause of propionic acidemia type II (PA-2). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCCB