Recombinant Human PCAF Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCAF Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 731-832 of Human PCAF partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KAT2B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCAF Protein

  • CREBBP-associated factor
  • EC 2.3.1.48
  • GCN5
  • GCN5L
  • Histone acetylase PCAF
  • histone acetyltransferase KAT2B
  • Histone acetyltransferase PCAF
  • K(lysine) acetyltransferase 2B
  • KAT2B
  • Lysine acetyltransferase 2B
  • P
  • P/CAFGCN5
  • P300/CBP-associated factorCAF
  • PCAF

Background

PCAF - p300/CBP-associated factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-60052
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for PCAF Partial Recombinant Protein (H00008850-Q02) (0)

There are no publications for PCAF Partial Recombinant Protein (H00008850-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCAF Partial Recombinant Protein (H00008850-Q02) (0)

There are no reviews for PCAF Partial Recombinant Protein (H00008850-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCAF Partial Recombinant Protein (H00008850-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCAF Products

Bioinformatics Tool for PCAF Partial Recombinant Protein (H00008850-Q02)

Discover related pathways, diseases and genes to PCAF Partial Recombinant Protein (H00008850-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCAF Partial Recombinant Protein (H00008850-Q02)

Discover more about diseases related to PCAF Partial Recombinant Protein (H00008850-Q02).
 

Pathways for PCAF Partial Recombinant Protein (H00008850-Q02)

View related products by pathway.

PTMs for PCAF Partial Recombinant Protein (H00008850-Q02)

Learn more about PTMs related to PCAF Partial Recombinant Protein (H00008850-Q02).
 

Research Areas for PCAF Partial Recombinant Protein (H00008850-Q02)

Find related products by research area.

Blogs on PCAF

There are no specific blogs for PCAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PCAF Antibody (5E11.)
H00008850-M04

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCAF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT2B
Entrez