PBX2 Antibody (2E9) - Azide and BSA Free

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody (M01), clone 2E9.Lane 1: PBX2 transfected lysate(45.9 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of monoclonal antibody to PBX2 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ( Cat # H00005089-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody (M01), clone 2E9 (Cat # H00005089-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - PBX2 monoclonal antibody (M01), clone 2E9 Analysis of PBX2 expression in Hela S3 NE.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, KD
• Clone: 2E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PBX2 Antibody (2E9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PBX2 (NP_002577, 354 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
• Specificity: PBX2 - pre-B-cell leukemia transcription factor 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PBX2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PBX2 Antibody (2E9) - Azide and BSA Free

• G17Homeobox protein PBX2
• HOX12homeobox 12
• PBX2MHC
• pre-B-cell leukemia homeobox 2
• pre-B-cell leukemia transcription factor 2
• Protein G17

Background

This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PBX2 Antibody (H00005089-M01)(1)

Publication using H00005089-M01

• Wright EK Jr, Page SH, Barber SA, Clements JE Prep1/Pbx2 complexes regulate CCL2 expression through the -2578 guanine polymorphism. Genes Immun 2008-07-01 [PMID: 18480829]

Bioinformatics

• Gene Symbol: PBX2
• Entrez:
  • 5089(Human)
• OMIM:
  • 176311(Human)
• Uniprot:
  • NP_002577(Human)