PBX2 Antibody (2E9.)


Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - PBX2 monoclonal antibody (M01), clone 2E9 Analysis of PBX2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of monoclonal antibody to PBX2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ( Cat # H00005089-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody (M01), clone 2E9.Lane 1: PBX2 transfected lysate(45.9 KDa).Lane 2: ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi

Order Details

PBX2 Antibody (2E9.) Summary

PBX2 (NP_002577 354 a.a. - 430 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
PBX2 - pre-B-cell leukemia transcription factor 2
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.
Read Publication using H00005089-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PBX2 Antibody (2E9.)

  • G17Homeobox protein PBX2
  • HOX12homeobox 12
  • pre-B-cell leukemia homeobox 2
  • pre-B-cell leukemia transcription factor 2
  • Protein G17


This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi

Publications for PBX2 Antibody (H00005089-M01)(1)

Reviews for PBX2 Antibody (H00005089-M01) (0)

There are no reviews for PBX2 Antibody (H00005089-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PBX2 Antibody (H00005089-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PBX2 Products

Bioinformatics Tool for PBX2 Antibody (H00005089-M01)

Discover related pathways, diseases and genes to PBX2 Antibody (H00005089-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBX2 Antibody (H00005089-M01)

Discover more about diseases related to PBX2 Antibody (H00005089-M01).

Pathways for PBX2 Antibody (H00005089-M01)

View related products by pathway.

PTMs for PBX2 Antibody (H00005089-M01)

Learn more about PTMs related to PBX2 Antibody (H00005089-M01).

Blogs on PBX2

There are no specific blogs for PBX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PBX2 Antibody (2E9.) and receive a gift card or discount.


Gene Symbol PBX2