We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PBK Recombinant Protein Antigen

Images

 
There are currently no images for PBK Recombinant Protein Antigen (NBP2-58043PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PBK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PBK.

Source: E. coli

Amino Acid Sequence: ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PBK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58043.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PBK Recombinant Protein Antigen

  • Cancer/testis antigen 84
  • CT84MAPKK-like protein kinase
  • EC 2.7.12.2
  • FLJ14385
  • Nori-3PDZ-binding kinase
  • PDZ binding kinase
  • serine/threonine protein kinase
  • Spermatogenesis-related protein kinase
  • SPKT-LAK cell-originated protein kinase
  • TOPKlymphokine-activated killer T-cell-originated protein kinase

Background

PBK encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-82473
Species: Rt
Applications: ELISA
NBP3-09949
Species: Hu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
291-G1
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67344
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP3-35070
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P

Publications for PBK Recombinant Protein Antigen (NBP2-58043PEP) (0)

There are no publications for PBK Recombinant Protein Antigen (NBP2-58043PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBK Recombinant Protein Antigen (NBP2-58043PEP) (0)

There are no reviews for PBK Recombinant Protein Antigen (NBP2-58043PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PBK Recombinant Protein Antigen (NBP2-58043PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PBK Products

Research Areas for PBK Recombinant Protein Antigen (NBP2-58043PEP)

Find related products by research area.

Blogs on PBK

There are no specific blogs for PBK, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PBK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PBK