Recombinant Human PAQR9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PAQR9 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 377 of Human PAQR9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPRRLQPRGAGTKGPPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYLQQRLGWHVDCTRLIAAYRALVLPVAFVLAVACTVACCKSRTDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTVGYMLLLVVCLGLVIRKFLNSSEFCSKK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PAQR9
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PAQR9 Protein

  • progestin and adipoQ receptor family member 9
  • progestin and adipoQ receptor family member IXFLJ41938

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-57962
Species: Hu
Applications: WB, ICC/IF
NBP1-84813
Species: Hu
Applications: IHC, IHC-P
NBP2-07799
Species: Hu
NLS418
Species: Hu
Applications: IHC-P
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30010
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005408-D01P
Species: Hu, Mu
Applications: WB
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87316
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00344838-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PAQR9 Recombinant Protein (H00344838-P01) (0)

There are no publications for PAQR9 Recombinant Protein (H00344838-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAQR9 Recombinant Protein (H00344838-P01) (0)

There are no reviews for PAQR9 Recombinant Protein (H00344838-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAQR9 Recombinant Protein (H00344838-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAQR9 Products

Bioinformatics Tool for PAQR9 Recombinant Protein (H00344838-P01)

Discover related pathways, diseases and genes to PAQR9 Recombinant Protein (H00344838-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAQR9 Recombinant Protein (H00344838-P01)

Discover more about diseases related to PAQR9 Recombinant Protein (H00344838-P01).
 

Pathways for PAQR9 Recombinant Protein (H00344838-P01)

View related products by pathway.

Blogs on PAQR9

There are no specific blogs for PAQR9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PAQR9 Antibody
NBP2-30402
PGRMC1 Antibody
NBP1-83220

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PAQR9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAQR9