PAPD4 Antibody

Images

 
Western Blot: PAPD4 Antibody [NBP1-69060] - Titration: 0.2-1 ug/ml, Positive Control: Rat Kidney.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAPD4 Antibody Summary

Immunogen
Synthetic peptides corresponding to Papd4 (PAP associated domain containing 4) The peptide sequence was selected from the C terminal of Papd4. Peptide sequence YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAPD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Papd4 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAPD4 Antibody

  • EC 2.7.7.19
  • FLJ38499
  • GLD2TUTase 2
  • hGLD-2
  • PAP associated domain containing 4
  • PAP-associated domain-containing protein 4
  • poly(A) RNA polymerase GLD2
  • Terminal uridylyltransferase 2

Background

Papd4 is a cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. Papd4 does not play a role in replication-dependent histone mRNA degradation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-83027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82257
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00338917-T01
Species: Hu
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40588
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready

Publications for PAPD4 Antibody (NBP1-69060) (0)

There are no publications for PAPD4 Antibody (NBP1-69060).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAPD4 Antibody (NBP1-69060) (0)

There are no reviews for PAPD4 Antibody (NBP1-69060). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAPD4 Antibody (NBP1-69060) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAPD4 Products

Bioinformatics Tool for PAPD4 Antibody (NBP1-69060)

Discover related pathways, diseases and genes to PAPD4 Antibody (NBP1-69060). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PAPD4 Antibody (NBP1-69060)

View related products by pathway.

PTMs for PAPD4 Antibody (NBP1-69060)

Learn more about PTMs related to PAPD4 Antibody (NBP1-69060).

Blogs on PAPD4

There are no specific blogs for PAPD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAPD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPD4
Uniprot