![Western Blot: PAP39 Antibody (5H10) [H00005635-M01-100ug] - Detection against Immunogen (35.86 KDa) .](http://images.novusbio.com/fullsize/PAP39-Antibody-5H10-Western-Blot-H00005635-M01-100ug-img0003.jpg "Western Blot: PAP39 Antibody (5H10) [H00005635-M01-100ug] - Detection against Immunogen (35.86 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 5H10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse PAP39 Antibody (5H10) - Azide and BSA Free (H00005635-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PRPSAP1 (AAH09012.1, 175 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMDDGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFV |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PRPSAP1 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRPSAP1 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Western Blot: PAP39 Antibody (5H10) [H00005635-M01-100ug] - Analysis of PRPSAP1 expression in transfected 293T cell line by PRPSAP1 monoclonal antibody (M01), clone 5H10. Lane 1: PRPSAP1 transfected lysate (Predicted MW: 39.4 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PAP39-Antibody-5H10-Western-Blot-H00005635-M01-100ug-img0002.jpg "Western Blot: PAP39 Antibody (5H10) [H00005635-M01-100ug] - Analysis of PRPSAP1 expression in transfected 293T cell line by PRPSAP1 monoclonal antibody (M01), clone 5H10. Lane 1: PRPSAP1 transfected lysate (Predicted MW: 39.4 KDa). Lane 2: Non-transfected lysate.")
![ELISA: PAP39 Antibody (5H10) [H00005635-M01-100ug] - Detection limit for recombinant GST tagged PRPSAP1 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PAP39-Antibody-5H10-ELISA-H00005635-M01-100ug-img0001.jpg "ELISA: PAP39 Antibody (5H10) [H00005635-M01-100ug] - Detection limit for recombinant GST tagged PRPSAP1 is 0.1 ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")