Recombinant Human Pannexin-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Pannexin-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 327-425 of Human PANX1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSS

Protein/Peptide Type
Partial Recombinant Protein
Gene
PANX1

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pannexin-1 Protein

  • Innexin
  • MGC21309
  • MRS1
  • MRS1innexin
  • pannexin 1
  • Pannexin1
  • Pannexin-1
  • PANX1
  • PX1
  • UNQ2529

Background

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
MAB7088
Species: Hu
Applications: WB
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB8169
Species: Hu
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Pannexin-1 Partial Recombinant Protein (H00024145-Q01) (0)

There are no publications for Pannexin-1 Partial Recombinant Protein (H00024145-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pannexin-1 Partial Recombinant Protein (H00024145-Q01) (0)

There are no reviews for Pannexin-1 Partial Recombinant Protein (H00024145-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pannexin-1 Partial Recombinant Protein (H00024145-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pannexin-1 Products

Bioinformatics Tool for Pannexin-1 Partial Recombinant Protein (H00024145-Q01)

Discover related pathways, diseases and genes to Pannexin-1 Partial Recombinant Protein (H00024145-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pannexin-1 Partial Recombinant Protein (H00024145-Q01)

Discover more about diseases related to Pannexin-1 Partial Recombinant Protein (H00024145-Q01).
 

Pathways for Pannexin-1 Partial Recombinant Protein (H00024145-Q01)

View related products by pathway.

PTMs for Pannexin-1 Partial Recombinant Protein (H00024145-Q01)

Learn more about PTMs related to Pannexin-1 Partial Recombinant Protein (H00024145-Q01).

Blogs on Pannexin-1

There are no specific blogs for Pannexin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pannexin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PANX1
Entrez