Recombinant Human Pancreatic Lipase Related Protein 2 Protein

Images

 
SDS-Page: Recombinant Human Pancreatic Lipase Related Protein 2 Protein [H00005408-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Pancreatic Lipase Related Protein 2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 469 of Human PNLIPRP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PNLIPRP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
78.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pancreatic Lipase Related Protein 2 Protein

  • EC 3.1.1
  • EC 3.1.1.3
  • galactolipase
  • pancreatic lipase-related protein 2
  • PL-RP2
  • PLRP2EC 3.1.1.26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38958
Species: Hu
Applications: IHC, IHC-P
AF7105
Species: Hu
Applications: WB
NBP1-86109
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
6507-IL/CF
Species: Hu
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB
NBP1-83966
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-03286
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF8125
Species: Hu, Mu
Applications: WB, Simple Western, IHC
MAB5018
Species: Hu
Applications: WB, IP
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-111
Species: Hu, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01) (0)

There are no publications for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01) (0)

There are no reviews for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Pancreatic Lipase Related Protein 2 Products

Bioinformatics Tool for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01)

Discover related pathways, diseases and genes to Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01)

Discover more about diseases related to Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01).
 

Pathways for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01)

View related products by pathway.

Research Areas for Pancreatic Lipase Related Protein 2 Recombinant Protein (H00005408-P01)

Find related products by research area.

Blogs on Pancreatic Lipase Related Protein 2

There are no specific blogs for Pancreatic Lipase Related Protein 2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pancreatic Lipase Related Protein 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PNLIPRP2
Novus 100% Guarantee