Recombinant Human Pancreatic Lipase Related Protein 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Pancreatic Lipase Related Protein 2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 333 - 435 of Human PNLIPRP2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PNLIPRP2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pancreatic Lipase Related Protein 2 Protein

  • EC 3.1.1
  • EC 3.1.1.3
  • galactolipase
  • pancreatic lipase-related protein 2
  • PL-RP2
  • PLRP2EC 3.1.1.26

Background

PNLIPRP2 - pancreatic lipase-related protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7105
Species: Hu
Applications: WB
NBP1-86109
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-46376
Species: Hu
Applications: WB, IHC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB
NBL1-12547
Species: Hu
NBP1-83966
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
H00005408-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01) (0)

There are no publications for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01) (0)

There are no reviews for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pancreatic Lipase Related Protein 2 Products

Bioinformatics Tool for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01)

Discover related pathways, diseases and genes to Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01)

Discover more about diseases related to Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01).
 

Pathways for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01)

View related products by pathway.

Research Areas for Pancreatic Lipase Related Protein 2 Partial Recombinant Protein (H00005408-Q01)

Find related products by research area.

Blogs on Pancreatic Lipase Related Protein 2

There are no specific blogs for Pancreatic Lipase Related Protein 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pancreatic Lipase Related Protein 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PNLIPRP2