PALS1/MPP5 Antibody

Product Discontinued

PALS1/MPP5 Antibody Summary

• Immunogen: Synthetic peptides corresponding to MPP5(membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)) The peptide sequence was selected from the middle region of MPP5 (NP_071919). LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELRE
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against MPP5 and was validated on Western blot.
• Theoretical MW: 77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PALS1/MPP5 Antibody

• MAGUK p55 subfamily member 5
• membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
• MPP5
• PALS1
• PALS1FLJ12615
• Stardust

Background

Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling protei

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPP5
• Entrez:
  • 64398(Human)
• Uniprot:
  • Q8N3R9(Human)