Recombinant Human PACRG Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PACRG Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 110 of Human PACRG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNRIAWKVEIEKLDYHHYLP

Protein/Peptide Type
Partial Recombinant Protein
Gene
PACRG

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PACRG Protein

  • FLJ32724
  • Glup
  • HAK005771
  • Molecular chaperone/chaperonin-binding protein
  • PARK2 coregulated gene protein
  • PARK2 co-regulated
  • PARK2CRG
  • parkin coregulated gene protein
  • parkin co-regulated gene protein
  • RP3-495O10.2

Background

PACRG - PARK2 co-regulated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87178
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4975
Species: Hu
Applications: IHC
NBP1-87989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
H00135138-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PACRG Partial Recombinant Protein (H00135138-Q01) (0)

There are no publications for PACRG Partial Recombinant Protein (H00135138-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACRG Partial Recombinant Protein (H00135138-Q01) (0)

There are no reviews for PACRG Partial Recombinant Protein (H00135138-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PACRG Partial Recombinant Protein (H00135138-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PACRG Products

Bioinformatics Tool for PACRG Partial Recombinant Protein (H00135138-Q01)

Discover related pathways, diseases and genes to PACRG Partial Recombinant Protein (H00135138-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACRG Partial Recombinant Protein (H00135138-Q01)

Discover more about diseases related to PACRG Partial Recombinant Protein (H00135138-Q01).
 

Pathways for PACRG Partial Recombinant Protein (H00135138-Q01)

View related products by pathway.

PTMs for PACRG Partial Recombinant Protein (H00135138-Q01)

Learn more about PTMs related to PACRG Partial Recombinant Protein (H00135138-Q01).

Blogs on PACRG

There are no specific blogs for PACRG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PACRG Antibody
NBP1-03274
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PACRG Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PACRG