PAC1R Antibody

Immunohistochemistry-Paraffin: PAC1R Antibody [NBP2-47340] - Staining in human cerebral cortex and pancreas tissues using anti-ADCYAP1R1 antibody. Corresponding ADCYAP1R1 RNA-seq data are presented for the same tissues.

Western Blot: PAC1R Antibody [NBP2-47340] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: PAC1R Antibody [NBP2-47340] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PAC1R Antibody [NBP2-47340] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PAC1R Antibody [NBP2-47340] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PAC1R Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADCYAP1R1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  PAC1R Protein (NBP2-47340PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PAC1R Antibody

• ADCYAP1R1
• adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1
• adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
• PAC1R
• PACAP type I receptor
• PACAPR
• PACAP-R1
• PACAP-R-1
• PACAPRI
• PACAPRPAC1
• pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop
• pituitary adenylate cyclase-activating polypeptide type I receptor

Background

The pituitary adenylate cyclase-activating peptide receptor (PAC1) is a member of a family of three G-protein coupled receptors which mediate VIP (vasoactive intestinal peptide) and PACAP (pituitary adenlyate cyclase activating peptide) function in a variety of tissues. PAC1 demonstrates a higher affinity for PACAP than VIP. Expression of the VIP and VACAP receptors has been linked to the presence of human tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADCYAP1R1