PAC1R Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PAC1R Antibody - BSA Free (NBP2-47340) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADCYAP1R1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 0.04-0.4 ug/ml
|
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PAC1R Antibody - BSA Free
Background
The pituitary adenylate cyclase-activating peptide receptor (PAC1) is a member of a family of three G-protein coupled receptors which mediate VIP (vasoactive intestinal peptide) and PACAP (pituitary adenlyate cyclase activating peptide) function in a variety of tissues. PAC1 demonstrates a higher affinity for PACAP than VIP. Expression of the VIP and VACAP receptors has been linked to the presence of human tumors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Publications for PAC1R Antibody (NBP2-47340) (0)
There are no publications for PAC1R Antibody (NBP2-47340).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PAC1R Antibody (NBP2-47340) (0)
There are no reviews for PAC1R Antibody (NBP2-47340).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PAC1R Antibody (NBP2-47340) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PAC1R Products
Research Areas for PAC1R Antibody (NBP2-47340)
Find related products by research area.
|
Blogs on PAC1R