Recombinant Human PA28 Activator beta Subunit/PSME2 Protein

Product Discontinued

Recombinant Human PA28 Activator beta Subunit/PSME2 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 32874 of Human PSME2 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: PSME2

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PA28 Activator beta Subunit/PSME2 Protein

• 11S regulator complex beta subunit
• 11S regulator complex subunit beta
• Activator of multicatalytic protease subunit 2
• MCP Activator
• MCP activator, 31-kD subunit
• PA28 Activator beta Subunit
• PA28b
• PA28betacell migration-inducing protein 22
• proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
• Proteasome activator 28 subunit beta
• proteasome activator 28-beta
• proteasome activator complex subunit 2
• proteasome activator hPA28 subunit beta
• PSME2
• REGbeta
• REG-beta

Background

PSME2 - proteasome (prosome, macropain) activator subunit 2 (PA28 beta)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PSME2