p70 S6 Kinase/S6K Antibody (4H4)

Images

 
Western Blot: p70 S6 Kinase/S6K Antibody (4H4) [H00006198-M04] - Analysis of RPS6KB1 expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase/S6K Antibody (4H4) [H00006198-M04] - Analysis of monoclonal antibody to RPS6KB1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: p70 S6 Kinase/S6K Antibody (4H4) [H00006198-M04] - s6k in fibroblasts. Image from verified customer review.
Western Blot: p70 S6 Kinase/S6K Antibody (4H4) [H00006198-M04] - Analysis of RPS6KB1 expression in HeLa (Cat # L013V1).
Western Blot: p70 S6 Kinase/S6K Antibody (4H4) [H00006198-M04] - Analysis of RPS6KB1 expression in PC-12 (Cat # L012V1).
Western Blot: p70 S6 Kinase/S6K Antibody (4H4) [H00006198-M04] - Analysis of RPS6KB1 expression in NIH/3T3 (Cat # L018V1).
ELISA: p70 S6 Kinase/S6K Antibody (4H4) [H00006198-M04] - Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p70 S6 Kinase/S6K Antibody (4H4) Summary

Immunogen
RPS6KB1 (NP_003152 416 a.a. - 525 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS6KB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA, IF and WB.
Reviewed Applications
Read 1 Review rated 4
using
H00006198-M04 in the following applications:

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p70 S6 Kinase/S6K Antibody (4H4)

  • EC 2.7.11
  • EC 2.7.11.1
  • p70 ribosomal S6 kinase alpha
  • p70 S6 kinase alpha
  • p70 S6 Kinase
  • p70 S6 kinase, alpha 1,70 kDa ribosomal protein S6 kinase 1
  • p70 S6 kinase, alpha 2
  • p70 S6KA
  • p70 S6K-alpha
  • p70(S6K)-alpha
  • p70-alpha
  • p70-S6K
  • P70S6K1
  • PS6K
  • ribosomal protein S6 kinase beta-1
  • Ribosomal protein S6 kinase I
  • ribosomal protein S6 kinase, 70kD, polypeptide 1
  • ribosomal protein S6 kinase, 70kDa, polypeptide 1
  • RPS6KB1
  • S6K
  • S6K1
  • S6K1p70-S6K 1
  • S6K-beta-1
  • serine/threonine kinase 14 alpha
  • Serine/threonine-protein kinase 14A
  • STK14A

Background

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
H00006198-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for p70 S6 Kinase/S6K Antibody (H00006198-M04) (0)

There are no publications for p70 S6 Kinase/S6K Antibody (H00006198-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for p70 S6 Kinase/S6K Antibody (H00006198-M04) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00006198-M04:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot p70 S6 Kinase/S6K H00006198-M04
Enlarge
reviewed by:
Jennifer Fox
WB Human 07/10/2014
View

Summary

ApplicationWestern Blot
Sample Tested fibroblasts
SpeciesHuman
Lot7261-4H4-00Aa6

Blocking

Blocking Details5% Milk-TBS/T, 1 hour room temperature

Primary Anitbody

Dilution Ratio1:500, 4C overnight in 5% milk-tbs/t

Secondary Antibody

Secondary DescriptionECL Mouse IgG, HRP-linked whole Ab (from sheep)
Secondary Manufacturer Cat#NA931-1ML
Secondary Concentration1:5000

Details

Detection NotesECL, 1 minute exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p70 S6 Kinase/S6K Antibody (H00006198-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p70 S6 Kinase/S6K Products

Bioinformatics Tool for p70 S6 Kinase/S6K Antibody (H00006198-M04)

Discover related pathways, diseases and genes to p70 S6 Kinase/S6K Antibody (H00006198-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p70 S6 Kinase/S6K Antibody (H00006198-M04)

Discover more about diseases related to p70 S6 Kinase/S6K Antibody (H00006198-M04).
 

Pathways for p70 S6 Kinase/S6K Antibody (H00006198-M04)

View related products by pathway.

PTMs for p70 S6 Kinase/S6K Antibody (H00006198-M04)

Learn more about PTMs related to p70 S6 Kinase/S6K Antibody (H00006198-M04).
 

Research Areas for p70 S6 Kinase/S6K Antibody (H00006198-M04)

Find related products by research area.

Blogs on p70 S6 Kinase/S6K.

S6K - a serine/threonine kinase with diverse roles in cell survival and cell cycle progression
S6K is a serine/threonine kinase that is a member of the ribosomal S6 kinase (RSK) family. S6K exists in two main isoforms, S6K1 and S6K2, which can also be alternatively spliced to produce different splice forms. S6K1 has two major splicing produ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Jennifer Fox
07/10/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol RPS6KB1
Entrez
OMIM
Uniprot