p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen

Images

 
There are currently no images for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPS6KB2.

Source: E. coli

Amino Acid Sequence: VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPS6KB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87805.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • KLS
  • p70 ribosomal S6 kinase beta
  • p70 S6 Kinase beta
  • p70 S6KB
  • p70 S6K-beta
  • p70(S6K)-beta
  • p70-beta
  • P70-beta-1
  • P70-beta-2
  • p70-S6K 2
  • P70S6K2
  • p70S6Kb
  • ribosomal protein S6 kinase beta-2
  • ribosomal protein S6 kinase, 70kD, polypeptide 2,70 kDa ribosomal protein S6 kinase 2
  • ribosomal protein S6 kinase, 70kDa, polypeptide 2
  • RPS6KB2
  • S6K2
  • S6K-beta
  • S6K-beta2
  • S6K-beta-2
  • serine/threonine-protein kinase 14 beta
  • Serine/threonine-protein kinase 14B
  • SRK
  • STK14B
  • STK14BS6 kinase-related kinase

Background

S6K2 encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-20362
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87581
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB79671
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF4589
Species: Hu
Applications: IHC, WB
233-FB
Species: Hu
Applications: BA

Publications for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP) (0)

There are no publications for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP) (0)

There are no reviews for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p70 S6 Kinase beta/S6K2 Products

Research Areas for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP)

Find related products by research area.

Blogs on p70 S6 Kinase beta/S6K2

There are no specific blogs for p70 S6 Kinase beta/S6K2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KB2