Recombinant Human p400 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human p400 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 743-850 of Human EP400 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EP400
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p400 Protein

  • CAG repeat protein 32
  • CAGH32hDomino
  • DKFZP434I225
  • Domino homolog
  • E1A binding protein p400
  • E1A-binding protein p400
  • EC 3.6.1
  • EC 3.6.4.-
  • FLJ45115
  • KIAA1498p400 kDa SWI2/SNF2-related protein
  • KIAA1818
  • p400 SWI2/SNF2-related protein
  • P400
  • TNRC12FLJ42018
  • trinucleotide repeat containing 12
  • Trinucleotide repeat-containing gene 12 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, IF
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for p400 Partial Recombinant Protein (H00057634-Q01) (0)

There are no publications for p400 Partial Recombinant Protein (H00057634-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p400 Partial Recombinant Protein (H00057634-Q01) (0)

There are no reviews for p400 Partial Recombinant Protein (H00057634-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p400 Partial Recombinant Protein (H00057634-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p400 Products

Bioinformatics Tool for p400 Partial Recombinant Protein (H00057634-Q01)

Discover related pathways, diseases and genes to p400 Partial Recombinant Protein (H00057634-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p400 Partial Recombinant Protein (H00057634-Q01)

Discover more about diseases related to p400 Partial Recombinant Protein (H00057634-Q01).
 

Pathways for p400 Partial Recombinant Protein (H00057634-Q01)

View related products by pathway.

PTMs for p400 Partial Recombinant Protein (H00057634-Q01)

Learn more about PTMs related to p400 Partial Recombinant Protein (H00057634-Q01).
 

Research Areas for p400 Partial Recombinant Protein (H00057634-Q01)

Find related products by research area.

Blogs on p400

There are no specific blogs for p400, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
p400 Antibody
NB200-210

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human p400 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EP400