p38 gamma/SAPK3 Antibody

Images

 
Western Blot: p38 gamma/SAPK3 Antibody [H00006300-D01P] - Analysis of MAPK12 expression in transfected 293T cell line by MAPK12 polyclonal antibody.Lane 1: MAPK12 transfected lysate(41.90 KDa).Lane 2: Non-transfected ...read more
Proximity Ligation Assay: p38 gamma/SAPK3 Antibody [H00006300-D01P] - Analysis of protein-protein interactions between MAPK12 and DLG1. HeLa cells were stained with anti-MAPK12 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p38 gamma/SAPK3 Antibody Summary

Immunogen
MAPK12 (NP_002960.2, 1 a.a. - 367 a.a.) full-length human protein. MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Specificity
MAPK12 - mitogen-activated protein kinase 12,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPK12
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00006300-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p38 gamma/SAPK3 Antibody

  • EC 2.7.11
  • ERK3
  • ERK-6
  • ERK6MAPK 12
  • Extracellular signal-regulated kinase 6
  • MAP kinase 12
  • MAP kinase p38 gamma
  • MAPK12
  • mitogen-activated protein kinase 12
  • mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase p38 gamma
  • p38 gamma
  • p38gamma
  • PRKM12
  • SAPK-3
  • SAPK3EC 2.7.11.24
  • Stress-activated protein kinase 3

Background

Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
H00006300-D01P
Species: Hu
Applications: WB, PLA

Publications for p38 gamma/SAPK3 Antibody (H00006300-D01P)(1)

Reviews for p38 gamma/SAPK3 Antibody (H00006300-D01P) (0)

There are no reviews for p38 gamma/SAPK3 Antibody (H00006300-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p38 gamma/SAPK3 Antibody (H00006300-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p38 gamma/SAPK3 Products

Bioinformatics Tool for p38 gamma/SAPK3 Antibody (H00006300-D01P)

Discover related pathways, diseases and genes to p38 gamma/SAPK3 Antibody (H00006300-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p38 gamma/SAPK3 Antibody (H00006300-D01P)

Discover more about diseases related to p38 gamma/SAPK3 Antibody (H00006300-D01P).
 

Pathways for p38 gamma/SAPK3 Antibody (H00006300-D01P)

View related products by pathway.

PTMs for p38 gamma/SAPK3 Antibody (H00006300-D01P)

Learn more about PTMs related to p38 gamma/SAPK3 Antibody (H00006300-D01P).
 

Research Areas for p38 gamma/SAPK3 Antibody (H00006300-D01P)

Find related products by research area.

Blogs on p38 gamma/SAPK3

There are no specific blogs for p38 gamma/SAPK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p38 gamma/SAPK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK12
Entrez
Uniprot