P2Y11/P2RY11 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2RY11. Source: E. coli
Amino Acid Sequence: VLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
P2RY11 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87465. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for P2Y11/P2RY11 Recombinant Protein Antigen
Background
P2Y11, the only Purinergic Receptor that acts via cAMP, may be involved in the differentiation of immunocytes. Immature and mature dendritic cells express P2Y and P2X subtypes, including P2Y11, which are coupled to increases in intracellular Ca2+, membrane depolarization, and secretion of inflammatory cytokines. It has been suggested that ATP/P2Y11 contributes to sympathetic stimulation of renin, as well as to renin responses after tissue damage, such as that which occurs with kidney disease and myocardial infarct. Intergenic splicing between the P2Y11 and SSF1 genes changes gene expression, the first case involving a GPCR Communi et al., 2001. Prototypes for this cluster have been chosen to be uniquely P2Y11. P2Y11 has been reported in monocyte-derived dendritic cells, lymphocytes from patients with chronic lymphocytic leukemia, brain, heart, kidney, liver, skeletal muscle, spleen, and testis. ESTs have been isolated from normal human prostate, pancreas, and pooled brain, lung, and testis libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: AC
Publications for P2Y11/P2RY11 Recombinant Protein Antigen (NBP1-87465PEP) (0)
There are no publications for P2Y11/P2RY11 Recombinant Protein Antigen (NBP1-87465PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for P2Y11/P2RY11 Recombinant Protein Antigen (NBP1-87465PEP) (0)
There are no reviews for P2Y11/P2RY11 Recombinant Protein Antigen (NBP1-87465PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for P2Y11/P2RY11 Recombinant Protein Antigen (NBP1-87465PEP) (0)
Additional P2Y11/P2RY11 Products
Research Areas for P2Y11/P2RY11 Recombinant Protein Antigen (NBP1-87465PEP)
Find related products by research area.
|
Blogs on P2Y11/P2RY11