P2Y10/P2RY10 Antibody - BSA Free

Immunohistochemistry-Paraffin: P2Y10/P2RY10 Antibody [NBP2-56283] - Staining in human lymph node and cerebral cortex tissues using anti-P2RY10 antibody. Corresponding P2RY10 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: P2Y10/P2RY10 Antibody [NBP2-56283] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: P2Y10/P2RY10 Antibody [NBP2-56283] - Staining of human lymph node shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

P2Y10/P2RY10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  P2Y10/P2RY10 Recombinant Protein Antigen (NBP2-56283PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for P2Y10/P2RY10 Antibody - BSA Free

• G-protein coupled purinergic receptor P2Y10
• P2RY10
• P2Y purinoceptor 10
• P2Y10
• P2Y10P2Y-like receptor
• purinergic receptor P2Y, G-protein coupled, 10
• putative P2Y purinoceptor 10

Background

P2Y10 is a putative Purinergic Receptor. P2Y10 has been reported to be expressed in lymphoid cells and in monocytes derived from dendritic cells. ESTs have been isolated from tonsil, lymph, and placenta libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P2RY10