P2X7/P2RX7 Antibody

Images

 
Immunohistochemistry-Paraffin: C12orf76 Antibody [NBP2-14515] - Staining of human cerebral cortex shows weak positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P2X7/P2RX7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AEVKEEIVEKEMKKLVHSVFNMADYTFPLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P2RX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
P2X7/P2RX7 Recombinant Protein Antigen (NBP2-14515PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P2X7/P2RX7 Antibody

  • ATP receptor
  • MGC20089
  • P2RX7
  • P2X purinoceptor 7
  • P2X7
  • P2X7P2X7 receptor
  • P2X7R
  • P2Z receptor
  • purinergic receptor P2X, ligand-gated ion channel, 7
  • purinergic receptor P2X7 variant A
  • Purinergic receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59672
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14515
Species: Hu
Applications: IHC, IHC-P

Publications for P2X7/P2RX7 Antibody (NBP2-14515) (0)

There are no publications for P2X7/P2RX7 Antibody (NBP2-14515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X7/P2RX7 Antibody (NBP2-14515) (0)

There are no reviews for P2X7/P2RX7 Antibody (NBP2-14515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for P2X7/P2RX7 Antibody (NBP2-14515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P2X7/P2RX7 Products

Bioinformatics Tool for P2X7/P2RX7 Antibody (NBP2-14515)

Discover related pathways, diseases and genes to P2X7/P2RX7 Antibody (NBP2-14515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X7/P2RX7 Antibody (NBP2-14515)

Discover more about diseases related to P2X7/P2RX7 Antibody (NBP2-14515).
 

Pathways for P2X7/P2RX7 Antibody (NBP2-14515)

View related products by pathway.

PTMs for P2X7/P2RX7 Antibody (NBP2-14515)

Learn more about PTMs related to P2X7/P2RX7 Antibody (NBP2-14515).

Blogs on P2X7/P2RX7

There are no specific blogs for P2X7/P2RX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P2X7/P2RX7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX7
Entrez