P2X5/P2RX5 Antibody

Images

 
Western Blot: P2X5/P2RX5 Antibody [H00005026-B01P] - Analysis of P2RX5 expression in human pancreas.
Western Blot: P2X5/P2RX5 Antibody [H00005026-B01P] - Analysis of P2RX5 expression in transfected 293T cell line by P2RX5 polyclonal antibody. Lane 1: P2RX5 transfected lysate(46.42 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

P2X5/P2RX5 Antibody Summary

Immunogen
P2RX5 (NP_002552.2, 1 a.a. - 422 a.a.) full-length human protein. MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Specificity
Reacts with purinergic receptor P2X, ligand-gated ion channel, 5.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
P2RX5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for P2X5/P2RX5 Antibody

  • ATP receptor subunit
  • ATP receptor
  • ionotropic ATP receptor P2X5
  • LRH-1
  • MGC47755
  • P2RX5
  • P2X purinoceptor 5
  • P2X5
  • P2X5lymphoid-restricted histocompatibility antigen-1
  • P2X5R
  • purinergic receptor P2X ligand gated ion channel 5
  • purinergic receptor P2X, ligand-gated ion channel, 5
  • Purinergic receptor

Background

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30565
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-46522
Species: Hu
Applications: WB, IHC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB400-153
Species: Hu
Applications: WB, ICC/IF
MAB9120
Species: Hu
Applications: ICC
PP-H7431-00
Species: Hu
Applications: WB
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30741
Species: Hu, Mu, Rt, GP
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
H00005026-B01P
Species: Hu
Applications: WB

Publications for P2X5/P2RX5 Antibody (H00005026-B01P) (0)

There are no publications for P2X5/P2RX5 Antibody (H00005026-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X5/P2RX5 Antibody (H00005026-B01P) (0)

There are no reviews for P2X5/P2RX5 Antibody (H00005026-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2X5/P2RX5 Antibody (H00005026-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P2X5/P2RX5 Products

Bioinformatics Tool for P2X5/P2RX5 Antibody (H00005026-B01P)

Discover related pathways, diseases and genes to P2X5/P2RX5 Antibody (H00005026-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X5/P2RX5 Antibody (H00005026-B01P)

Discover more about diseases related to P2X5/P2RX5 Antibody (H00005026-B01P).
 

Pathways for P2X5/P2RX5 Antibody (H00005026-B01P)

View related products by pathway.

PTMs for P2X5/P2RX5 Antibody (H00005026-B01P)

Learn more about PTMs related to P2X5/P2RX5 Antibody (H00005026-B01P).

Blogs on P2X5/P2RX5

There are no specific blogs for P2X5/P2RX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P2X5/P2RX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX5
Entrez
Uniprot