p27/Kip1 Antibody (4B4-E6)

Images

 
Western Blot: p27/Kip1 Antibody (4B4-E6) [H00001027-M01] - Analysis of CDKN1B expression in transfected 293T cell line by CDKN1B monoclonal antibody (M01), clone 4B4-E6.Lane 1: CDKN1B transfected lysate(22.1 KDa).Lane ...read more
Immunocytochemistry/ Immunofluorescence: p27/Kip1 Antibody (4B4-E6) [H00001027-M01] - Analysis of monoclonal antibody to CDKN1B on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: p27/Kip1 Antibody (4B4-E6) [H00001027-M01] - Analysis of monoclonal antibody to CDKN1B on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. Antibody concentration ...read more
Western Blot: p27/Kip1 Antibody (4B4-E6) [H00001027-M01] - Western Blot analysis of CDKN1B expression in HL-60 ( Cat # L014V1 ).
Proximity Ligation Assay: p27/Kip1 Antibody (4B4-E6) [H00001027-M01] - Analysis of protein-protein interactions between AKT1 and CDKN1B. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: p27/Kip1 Antibody (4B4-E6) [H00001027-M01] - Detection limit for recombinant GST tagged CDKN1B is 10 ng/ml as a capture antibody.
Sandwich ELISA: p27/Kip1 Antibody (4B4-E6) [H00001027-M01] - Detection limit for recombinant GST tagged CDKN1B is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, PLA
Clone
4B4-E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p27/Kip1 Antibody (4B4-E6) Summary

Immunogen
CDKN1B (AAH01971, 1 a.a. - 198 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Specificity
CDKN1B - cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDKN1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using H00001027-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p27/Kip1 Antibody (4B4-E6)

  • CDKN1B
  • CDKN4
  • cyclin-dependent kinase inhibitor 1B (p27, Kip1)
  • cyclin-dependent kinase inhibitor 1B
  • Cyclin-dependent kinase inhibitor p27
  • Kip1
  • KIP1P27KIP1
  • MEN1B
  • MEN4
  • p27
  • p27Kip1

Background

This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00056996-R01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for p27/Kip1 Antibody (H00001027-M01)(1)

Reviews for p27/Kip1 Antibody (H00001027-M01) (0)

There are no reviews for p27/Kip1 Antibody (H00001027-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p27/Kip1 Antibody (H00001027-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p27/Kip1 Products

Bioinformatics Tool for p27/Kip1 Antibody (H00001027-M01)

Discover related pathways, diseases and genes to p27/Kip1 Antibody (H00001027-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p27/Kip1 Antibody (H00001027-M01)

Discover more about diseases related to p27/Kip1 Antibody (H00001027-M01).
 

Pathways for p27/Kip1 Antibody (H00001027-M01)

View related products by pathway.

PTMs for p27/Kip1 Antibody (H00001027-M01)

Learn more about PTMs related to p27/Kip1 Antibody (H00001027-M01).
 

Research Areas for p27/Kip1 Antibody (H00001027-M01)

Find related products by research area.

Blogs on p27/Kip1

There are no specific blogs for p27/Kip1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p27/Kip1 Antibody (4B4-E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN1B
Entrez
OMIM
Uniprot