Recombinant Human p190RhoGAP Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human p190RhoGAP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-36 of Human GRLF1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ARHGAP35
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
29.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p190RhoGAP Protein

  • glucocorticoid receptor DNA binding factor 1
  • glucocorticoid receptor DNA-binding factor 1
  • glucocorticoid receptor repression factor 1
  • GRF1
  • GRF-1
  • GRLF1
  • KIAA1722
  • MGC10745
  • P190A
  • P190-A
  • p190ARhoGAP
  • p190RhoGAP
  • rho GAP p190A
  • Rho GTPase activating protein 35
  • rho GTPase-activating protein 35

Background

GRLF1( AAH03514, 1 a.a. - 37 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20158
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF7548
Species: Hu
Applications: IHC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-91258
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002909-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for p190RhoGAP Recombinant Protein (H00002909-P01) (0)

There are no publications for p190RhoGAP Recombinant Protein (H00002909-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p190RhoGAP Recombinant Protein (H00002909-P01) (0)

There are no reviews for p190RhoGAP Recombinant Protein (H00002909-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p190RhoGAP Recombinant Protein (H00002909-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p190RhoGAP Products

Bioinformatics Tool for p190RhoGAP Recombinant Protein (H00002909-P01)

Discover related pathways, diseases and genes to p190RhoGAP Recombinant Protein (H00002909-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p190RhoGAP Recombinant Protein (H00002909-P01)

Discover more about diseases related to p190RhoGAP Recombinant Protein (H00002909-P01).
 

Pathways for p190RhoGAP Recombinant Protein (H00002909-P01)

View related products by pathway.

PTMs for p190RhoGAP Recombinant Protein (H00002909-P01)

Learn more about PTMs related to p190RhoGAP Recombinant Protein (H00002909-P01).

Blogs on p190RhoGAP

There are no specific blogs for p190RhoGAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human p190RhoGAP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP35