p14ARF/CDKN2A Recombinant Protein Antigen

Images

 
There are currently no images for p14ARF/CDKN2A Recombinant Protein Antigen (NBP3-05521PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p14ARF/CDKN2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p14ARF/CDKN2A.

Source: E. coli

Amino Acid Sequence: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDKN2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05521.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p14ARF/CDKN2A Recombinant Protein Antigen

  • ARF
  • CDK4 inhibitor p16-INK4
  • CDK4IP14ARF
  • CDKN2
  • cell cycle negative regulator beta
  • CMM2P16-INK4A
  • Cyclin-dependent kinase 4 inhibitor A
  • cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4)
  • cyclin-dependent kinase inhibitor 2A
  • INK4
  • INK4A
  • MLMP16INK4
  • MTS-1
  • MTS1P14
  • Multiple tumor suppressor 1
  • p14
  • p14ARF
  • p16
  • p16-INK4
  • p16INK4a
  • p16-INK4a
  • P19
  • P19ARF
  • TP16

Background

P14ARF is an alternate reading frame (ARF) product of the CDKN2A locus, which acts as a tumor suppressor by inducing cell cycle arrest in G1 and G2 phases and apoptosis.

The INK4a-ARF locus is comprised of two tumor suppressors, p16INK4a and p14ARF. These two proteins are encoded by differential splicing of alternative first exons. The p16INK4a (exon 1 alpha) protein inhibits the cyclin D-dependent kinases (CDK) that control the phosphorylation of the Rb protein and cell proliferation. The p14ARF protein complexes with MDM2 within the nucleus, thus modulating the activity of the p53 protein. P14ARF is a potent tumor suppressor in the presence of wild-type p53, while mutant p53 substantially reduces growth inhibition by p14ARF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38209
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-26876
Species: Hu
Applications: IHC,  IHC-P
NBP2-47560
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
AF1555
Species: Hu
Applications: WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP3-05521PEP
Species: Hu
Applications: AC

Publications for p14ARF/CDKN2A Recombinant Protein Antigen (NBP3-05521PEP) (0)

There are no publications for p14ARF/CDKN2A Recombinant Protein Antigen (NBP3-05521PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p14ARF/CDKN2A Recombinant Protein Antigen (NBP3-05521PEP) (0)

There are no reviews for p14ARF/CDKN2A Recombinant Protein Antigen (NBP3-05521PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p14ARF/CDKN2A Recombinant Protein Antigen (NBP3-05521PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p14ARF/CDKN2A Products

Research Areas for p14ARF/CDKN2A Recombinant Protein Antigen (NBP3-05521PEP)

Find related products by research area.

Blogs on p14ARF/CDKN2A

There are no specific blogs for p14ARF/CDKN2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p14ARF/CDKN2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN2A