Recombinant Human OTX3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human OTX3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-88 of Human OTX3

Source: Wheat Germ

Amino Acid Sequence: MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHRKQRRSRTAFTAQQLEALEK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DMBX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OTX3 Protein

  • diencephalon/mesencephalon homeobox 1
  • diencephalon/mesencephalon homeobox protein 1
  • homeoprotein MBX
  • MBX
  • Orthodenticle homolog 3
  • OTX3
  • Paired-like homeobox protein DMBX1
  • PAXBorthodenticle homolog 3 (Drosophila)

Background

DMBX1 - diencephalon/mesencephalon homeobox 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-750
Species: Hu, Mu, Rt, Fi, Mk, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00005076-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP1-62297
Species: Hu
Applications: WB
H00009588-M01
Species: Hu, Bv
Applications: WB, DB, ELISA
H00127343-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for OTX3 Partial Recombinant Protein (H00127343-Q01) (0)

There are no publications for OTX3 Partial Recombinant Protein (H00127343-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTX3 Partial Recombinant Protein (H00127343-Q01) (0)

There are no reviews for OTX3 Partial Recombinant Protein (H00127343-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OTX3 Partial Recombinant Protein (H00127343-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional OTX3 Products

Bioinformatics Tool for OTX3 Partial Recombinant Protein (H00127343-Q01)

Discover related pathways, diseases and genes to OTX3 Partial Recombinant Protein (H00127343-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTX3 Partial Recombinant Protein (H00127343-Q01)

Discover more about diseases related to OTX3 Partial Recombinant Protein (H00127343-Q01).
 

Pathways for OTX3 Partial Recombinant Protein (H00127343-Q01)

View related products by pathway.

PTMs for OTX3 Partial Recombinant Protein (H00127343-Q01)

Learn more about PTMs related to OTX3 Partial Recombinant Protein (H00127343-Q01).

Blogs on OTX3

There are no specific blogs for OTX3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OTX3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DMBX1
Novus 100% Guarantee