Osteocrin Antibody

Images

 
Immunohistochemistry-Paraffin: Osteocrin Antibody [NBP2-13719] Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Osteocrin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLLLDELVSLENDVIETKKKRGFSGFGSPLDRLSAGSVDHKGKQRKVVDH PKRRFGIPMDRIGRNRLSNSRG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSTN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Osteocrin Protein (NBP2-13719PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Osteocrin Antibody

  • Musclin
  • Osteocrin
  • OSTN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88637
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Osteocrin Antibody (NBP2-13719) (0)

There are no publications for Osteocrin Antibody (NBP2-13719).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteocrin Antibody (NBP2-13719) (0)

There are no reviews for Osteocrin Antibody (NBP2-13719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Osteocrin Antibody (NBP2-13719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteocrin Products

Bioinformatics Tool for Osteocrin Antibody (NBP2-13719)

Discover related pathways, diseases and genes to Osteocrin Antibody (NBP2-13719). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteocrin Antibody (NBP2-13719)

Discover more about diseases related to Osteocrin Antibody (NBP2-13719).
 

Pathways for Osteocrin Antibody (NBP2-13719)

View related products by pathway.

PTMs for Osteocrin Antibody (NBP2-13719)

Learn more about PTMs related to Osteocrin Antibody (NBP2-13719).

Blogs on Osteocrin

There are no specific blogs for Osteocrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteocrin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OSTN
Entrez