Osteocrin Antibody

Product Discontinued

Osteocrin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLLLDELVSLENDVIETKKKRGFSGFGSPLDRLSAGSVDHKGKQRKVVDH PKRRFGIPMDRIGRNRLSNSRG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSTN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Osteocrin Antibody

• Musclin
• Osteocrin
• OSTN

Background

Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factorlinked to glucose metabolism in skeletal muscle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSTN