Osteoadherin/OSAD/OMD Antibody (1E10.)

Images

 
Western Blot: OMD Antibody (1E10) [H00004958-M01] - analysis of OMD expression in transfected 293T cell line by OMD monoclonal antibody (M01), clone 1E10. Lane 1: OMD transfected lysate (49.5 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Osteoadherin/OSAD/OMD Antibody (1E10.) Summary

Immunogen
OMD (NP_005005 274 a.a. - 383 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRF
Localization
Secreted, extracellular space, extracellular matrix.
Specificity
OMD - osteomodulin
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OMD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osteoadherin/OSAD/OMD Antibody (1E10.)

  • Keratan sulfate proteoglycan osteomodulin
  • KSPG osteomodulin
  • OMD
  • OSAD
  • osteoadherin proteoglycan
  • Osteoadherin
  • osteomodulin
  • SLRR2C
  • SLRR2Costeoadherin

Background

OMD may be implicated in the biomineralization processes. It has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
AF8218
Species: Hu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00004958-M01
Species: Hu
Applications: ELISA

Publications for Osteoadherin/OSAD/OMD Antibody (H00004958-M01) (0)

There are no publications for Osteoadherin/OSAD/OMD Antibody (H00004958-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteoadherin/OSAD/OMD Antibody (H00004958-M01) (0)

There are no reviews for Osteoadherin/OSAD/OMD Antibody (H00004958-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Osteoadherin/OSAD/OMD Antibody (H00004958-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteoadherin/OSAD/OMD Products

Bioinformatics Tool for Osteoadherin/OSAD/OMD Antibody (H00004958-M01)

Discover related pathways, diseases and genes to Osteoadherin/OSAD/OMD Antibody (H00004958-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteoadherin/OSAD/OMD Antibody (H00004958-M01)

Discover more about diseases related to Osteoadherin/OSAD/OMD Antibody (H00004958-M01).
 

Pathways for Osteoadherin/OSAD/OMD Antibody (H00004958-M01)

View related products by pathway.

PTMs for Osteoadherin/OSAD/OMD Antibody (H00004958-M01)

Learn more about PTMs related to Osteoadherin/OSAD/OMD Antibody (H00004958-M01).

Blogs on Osteoadherin/OSAD/OMD

There are no specific blogs for Osteoadherin/OSAD/OMD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteoadherin/OSAD/OMD Antibody (1E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol OMD
Entrez
Uniprot